PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000322.1_g00018.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family NAC
Protein Properties Length: 327aa    MW: 37271.1 Da    PI: 4.9921
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000322.1_g00018.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.51.1e-48601862128
                      NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkat 86 
                              ppGfrF P+d+el+ +yL k v++++l+  + i+ev++yk+ Pw+L  +  + +ek+wyfF++rd+ky++g+r+nra+ sg+Wkat
  Itr_sc000322.1_g00018.1  60 PPGFRFCPSDDELIECYLWKMVQNQPLPP-NKIHEVNLYKFSPWELSdMYETVGEKDWYFFTPRDRKYKNGQRPNRAAGSGFWKAT 144
                              9*************************999.77**************9444445899****************************** PP

                      NAM  87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                              g dk++++kk+ lvg +k Lvfy+g+ p+g kt+W+mheyr+
  Itr_sc000322.1_g00018.1 145 GADKSIMNKKKVLVGYRKALVFYQGKPPRGMKTNWIMHEYRV 186
                              ****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.2E-5856214IPR003441NAC domain
PROSITE profilePS5100555.64259214IPR003441NAC domain
PfamPF023658.7E-2560186IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MEEFLVPYHT SSTPTIFVGP SSDIAIVHDE NTIVVHKSNN RLINNNSFDD TNNDDGFNFP  60
PGFRFCPSDD ELIECYLWKM VQNQPLPPNK IHEVNLYKFS PWELSDMYET VGEKDWYFFT  120
PRDRKYKNGQ RPNRAAGSGF WKATGADKSI MNKKKVLVGY RKALVFYQGK PPRGMKTNWI  180
MHEYRVEGAP SPRPRGDAND MRLDDWVLCR IYNKTGKSSE KKLGKKFSPP PAEQSATAQA  240
VAVVSPSLPP PPPQIEPGMP PLIGDEFALA QFSFLSGQDE MDELPAFYYL TMENDMMIPN  300
DQPFHTANLD NLFITENDDD SIPKPME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A9e-595721413168Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016487930.11e-72PREDICTED: NAC transcription factor 29-like
TrEMBLK4D3D21e-71K4D3D2_SOLLC; Uncharacterized protein
TrEMBLM5X9E75e-71M5X9E7_PRUPE; Uncharacterized protein
STRINGSolyc10g083450.1.13e-71(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74624103
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G77450.12e-62NAC domain containing protein 32